Protein Info for BWI76_RS08125 in Klebsiella michiganensis M5al

Annotation: rRNA maturation RNase YbeY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF02130: YbeY" amino acids 21 to 142 (122 residues), 132.6 bits, see alignment E=3.9e-43 TIGR00043: rRNA maturation RNase YbeY" amino acids 40 to 144 (105 residues), 125 bits, see alignment E=7.4e-41

Best Hits

Swiss-Prot: 89% identical to YBEY_ENT38: Endoribonuclease YbeY (ybeY) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_13945)

Predicted SEED Role

"Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0T7 at UniProt or InterPro

Protein Sequence (155 amino acids)

>BWI76_RS08125 rRNA maturation RNase YbeY (Klebsiella michiganensis M5al)
MSQVILDLQLACEDNGGMPDEALFQRWVDSVIPQFQEESELTIRLVDEAESHELNLTYRG
KDKPTNVLSFPFEAPLGIEMPLLGDLVICRQVVEQEAKEQGKPLEAHWAHMVVHGSLHLL
GYDHIIDEEAEEMESLETEIMLALGYEDPYIAEKE