Protein Info for BWI76_RS08120 in Klebsiella michiganensis M5al

Annotation: cobalt transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF21917: NMB0537_N" amino acids 29 to 63 (35 residues), 47.2 bits, see alignment 2.1e-16 PF00571: CBS" amino acids 69 to 124 (56 residues), 35.7 bits, see alignment E=1.3e-12 amino acids 140 to 189 (50 residues), 28.8 bits, see alignment 2e-10 PF03471: CorC_HlyC" amino acids 206 to 282 (77 residues), 83.3 bits, see alignment E=1.5e-27

Best Hits

Swiss-Prot: 96% identical to CORC_ECO57: Magnesium and cobalt efflux protein CorC (corC) from Escherichia coli O157:H7

KEGG orthology group: K06189, magnesium and cobalt transporter (inferred from 99% identity to kpn:KPN_00683)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0P1 at UniProt or InterPro

Protein Sequence (292 amino acids)

>BWI76_RS08120 cobalt transporter (Klebsiella michiganensis M5al)
MSDDNSHSSDTVNSKKGFFSLLLSQLFHGEPKNRDELLALIRDSGQNDLIDEDTRDMLEG
VMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAK
DLLPFMRSDAEAFSMEKVLRPAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGLVT
IEDILELIVGEIEDEYDEEEDIDFRQLSRHTWTVRALASIEDFNEAYGTHFSDEEVDTIG
GLVMQAFGHLPARGESIDIDGYQFKVAMADSRRIIQVHVKLPDDAPQPKLED