Protein Info for BWI76_RS08090 in Klebsiella michiganensis M5al

Annotation: ShlB-type POTRA domain/hemolysin secretion/activation protein ShlB/FhaC/HecB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF08479: POTRA_2" amino acids 73 to 147 (75 residues), 53.5 bits, see alignment E=2.6e-18 PF17287: POTRA_3" amino acids 160 to 202 (43 residues), 44 bits, see alignment 1.7e-15 PF03865: ShlB" amino acids 208 to 520 (313 residues), 268.2 bits, see alignment E=1.7e-83

Best Hits

Swiss-Prot: 36% identical to CDIB_YERPE: Outer membrane transporter CdiB (cdib) from Yersinia pestis

KEGG orthology group: None (inferred from 68% identity to eae:EAE_13910)

Predicted SEED Role

"Channel-forming transporter/cytolysins activator of TpsB family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0U5 at UniProt or InterPro

Protein Sequence (556 amino acids)

>BWI76_RS08090 ShlB-type POTRA domain/hemolysin secretion/activation protein ShlB/FhaC/HecB (Klebsiella michiganensis M5al)
MKYNNNKLLNALFLYFIFTASTFADVANNTHQTEQDKARQSALKPEQQDYQSSRTGSHKY
KLIFPVEETCRYISHVNIISSNEKLTQRLLRNIAVQAEKKCLGIKGIRQLATALQNEIIV
QGYITSLIDIPSQSLEDGVLDITLTYGKIGNMIWSADSGATSSLWNAIPTATGEILKLTD
LEQGMANLQRLPGSSAQMKIQPGKNNAESDIQITRNLAKKWQVSAWMDDAGSRESGRYQS
GGALYLYDMATLNDIFYVSAGGDVEFNQHNDGNHNSSLYYSVPVGYWSLSLYGSQSEYRQ
QFKANYSTTEYKSENRYASATLSRLLSHTRQQKTTLDARIAKSTSRYYFGGSELKVMRKQ
NPVWELTLRQQRYFNKKIIDASLGIQRSLPWLSSMPTLEEKAGLYSPLSRVIHADIQAFM
KFDITGDRFSYAPHINAQFSPDILSTDNKFNIGSRWTVRGFDGENSLSGNQGWYWRNDFI
WDMPTPDRQLYFGLDIGRITGSEQYRQGKVISGAVSGLRGQLFSTQYDFFIGTPFIKPDR
FHSDPLNLGFSLNWRY