Protein Info for BWI76_RS08000 in Klebsiella michiganensis M5al

Annotation: lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 TIGR00510: lipoyl synthase" amino acids 21 to 321 (301 residues), 535.2 bits, see alignment E=2.3e-165 PF16881: LIAS_N" amino acids 26 to 73 (48 residues), 28 bits, see alignment 2.6e-10 PF04055: Radical_SAM" amino acids 89 to 252 (164 residues), 81 bits, see alignment E=1.2e-26

Best Hits

Swiss-Prot: 97% identical to LIPA_CROS8: Lipoyl synthase (lipA) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 96% identity to ecq:ECED1_0624)

MetaCyc: 96% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0K8 at UniProt or InterPro

Protein Sequence (321 amino acids)

>BWI76_RS08000 lipoyl synthase (Klebsiella michiganensis M5al)
MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKLPADSSRIQGIKAAMR
KNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVTPDANEPQKLA
QTIADMALRYVVVTSVDRDDLRDGGAQHFADCIKAIREKSPTIKIETLVPDFRGRMDRAL
EILQATPPDVFNHNLENVPRLYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGE
TNAEIVEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFEEMKAEAMAMGFTHAA
CGPFVRSSYHADLQAKGMEVK