Protein Info for BWI76_RS07965 in Klebsiella michiganensis M5al

Annotation: anaerobic C4-dicarboxylate transporter DcuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 28 to 49 (22 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 117 to 149 (33 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 307 to 363 (57 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 433 to 455 (23 residues), see Phobius details PF03606: DcuC" amino acids 6 to 451 (446 residues), 488.5 bits, see alignment E=1.7e-150 TIGR00771: transporter, anaerobic C4-dicarboxylate uptake C (DcuC) family" amino acids 58 to 441 (384 residues), 624.2 bits, see alignment E=5.3e-192 PF06808: DctM" amino acids 147 to 448 (302 residues), 37 bits, see alignment E=1.9e-13

Best Hits

Swiss-Prot: 89% identical to DCUC_ECOLI: Anaerobic C4-dicarboxylate transporter DcuC (dcuC) from Escherichia coli (strain K12)

KEGG orthology group: K03326, C4-dicarboxylate transporter, DcuC family (inferred from 94% identity to kpn:KPN_00654)

MetaCyc: 89% identical to anaerobic C4-dicarboxylate transporter DcuC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-106; TRANS-RXN-299; TRANS-RXN-300

Predicted SEED Role

"C4-dicarboxylate transporter DcuC (TC 2.A.61.1.1)" (TC 2.A.61.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0Q5 at UniProt or InterPro

Protein Sequence (457 amino acids)

>BWI76_RS07965 anaerobic C4-dicarboxylate transporter DcuC (Klebsiella michiganensis M5al)
MLTLVEILIGIVVIVGVARYIIKGYSATGVLFVGGLVLLIASALMGHKILPGDAKSTGYS
ATDIVEYIKILLMSRGGDLGMMIMMLCGFATYMTHIGANDMVVKLASKPLRFINSPYLLM
IAAYFVACLMSLAVSSATGLGVLLMATLFPVMVNVGISRGAAAAICASPAAIILSPTSGD
VVLAAKAAEMPLIDFAFKTTLPISIVAIICMAIAHFFWQRYLDKKENVAHEMLDVNEITT
TAPAFYAILPFTPIIGVLIFDGKWGPELHIITILVLCMLLAAVLEFCRGFNTKNVFNGLE
AAYRGMADAFAGVVMLLVAAGVFAQGLSTIGFINGLISIATSFGSASIILMLVLVILTML
AAMTTGSGNAPFYAFVEMIPKLAHSSGINPAYLSIPMLQASNLGRTISPVSGVVVAVAGM
AKISPFEVVKRTSVPVLVGLLVVIIATEVLVPGSAIR