Protein Info for BWI76_RS07930 in Klebsiella michiganensis M5al

Annotation: phosphoadenosine phosphosulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF01507: PAPS_reduct" amino acids 30 to 234 (205 residues), 55.9 bits, see alignment E=5.7e-19 PF11922: DUF3440" amino acids 237 to 340 (104 residues), 87.8 bits, see alignment E=8.2e-29 amino acids 353 to 385 (33 residues), 29.2 bits, see alignment (E = 7.6e-11)

Best Hits

Swiss-Prot: 74% identical to YBDN_ECOLI: Uncharacterized protein YbdN (ybdN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 85% identity to kpe:KPK_3927)

Predicted SEED Role

"Co-activator of prophage gene expression IbrA" in subsystem IbrA and IbrB: co-activators of prophage gene expression

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0R6 at UniProt or InterPro

Protein Sequence (407 amino acids)

>BWI76_RS07930 phosphoadenosine phosphosulfate reductase (Klebsiella michiganensis M5al)
MSFIKLPLPESVLQASQQRIEWVMENFSRICVSFSGGKDSTTMLHLTAQHARHTGKKICV
LFVDWEAQFSCTIAHCERMREEYRDVIEQFFWVALPLTTQNSLTQYNPEWQCWEPGANWV
RQPPKDAITDPGYFPFYQSGMSFETFVREFADWFSQNRPAAVMVGIRADESLNRFIAISS
QRKLRFADDKPWTTSAPGGHAWYIYPIYDWKTADIWTWFGKSGLSYNPLYNLMYQAGVPL
RYMRICEPFGPEQRQGLWLYHVLEPERWAAMCQRVSGVHCGGVYAGHDNQFYGHRKLDKP
EHHTWKSYALFLLDSMPEKTAEHYRNKIAVYLHWYQRRGMADIPDTQPADIGSKDIPSWR
RICKVLLNNDYWCRQLSFSPTKSHQYKRYRERMNKKRQQWGILCNDN