Protein Info for BWI76_RS07920 in Klebsiella michiganensis M5al

Annotation: methionine aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00155: Aminotran_1_2
  • amino acids 32 to 383 (352 residues), 196 bits, E=1.1e-61

Best Hits

Swiss-Prot: 84% identical to YBDL_ECOLI: Methionine aminotransferase (ybdL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_13740)

MetaCyc: 84% identical to methionine transaminase (Escherichia coli K-12 substr. MG1655)
R15-RXN [EC: 2.6.1.88]

Predicted SEED Role

"Methionine aminotransferase, PLP-dependent" in subsystem Methionine Salvage

MetaCyc Pathways

• ethene biosynthesis III (microbes) (6/7 steps found)
• dimethylsulfoniopropanoate biosynthesis III (algae and phytoplankton) (1/4 steps found)
• L-homomethionine biosynthesis (2/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.88

Sequence Analysis Tools

See A0A285B0R2 at UniProt or InterPro

Protein Sequence (386 amino acids)

>BWI76_RS07920 methionine aminotransferase (Klebsiella michiganensis M5al)
MSNKPLIPESKLPSLGTTIFSQMSALAQQHQAINLSQGFPDFDGPRYLQERLAYHVAQGA
NQYAPMTGVAALREAIVDKTEELYGYRPDANSDVTVTAGATEALYAAITALVRAGDEVIC
FDPSYDSYAPAIELSGGVLKRIALQPPHFRVDWQQFAASLSDKTRLVILNTPHNPSATVW
LREDFAALWQAIADREIYVLSDEVYEHICFAAEGHASVLAHPQLRERAVAVSSFGKTFHM
TGWKVGYCVAPAAISGELRKVHQYLTFAVNTPAQLAIADMLRREPEHYRQLPAFYRERRD
LFIDALRSSRLEILPCEGTYFLLADYSAVSDLDDVSFCRWLTTEIGVAAIPLSVFCADPF
PHKLIRLCFAKQPATLLAAAERLCRL