Protein Info for BWI76_RS07895 in Klebsiella michiganensis M5al

Annotation: sugar ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 PF00005: ABC_tran" amino acids 30 to 182 (153 residues), 88.9 bits, see alignment E=4.8e-29 amino acids 287 to 441 (155 residues), 67.9 bits, see alignment E=1.5e-22

Best Hits

Swiss-Prot: 42% identical to RBSA2_STRAW: Ribose import ATP-binding protein RbsA 2 (rbsA2) from Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)

KEGG orthology group: None (inferred from 86% identity to kva:Kvar_3727)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0I8 at UniProt or InterPro

Protein Sequence (517 amino acids)

>BWI76_RS07895 sugar ABC transporter ATPase (Klebsiella michiganensis M5al)
MITQSSGGTNPAAGLAMNQISKSFANVTALNAVTLLLNPGEIHGLIGENGAGKSTLIKIL
AGVYRADSGNATLDGAPLPLGNPAAIEALGIRVIHQELNLIPHFTVAESVFLGQEYRTRW
GALDRRRMNAATQAFFRDSWQLDINPRRLIRDLSLAERKLVQIARALIDGAAKLVVFDEP
TAPLEAQEASLVSSAILRLREQGIAILYISHYLNEIAALCDRGTVLRNGEVVGYPDRDLL
QNTDALIKMMVGRDIEQLYTPRQSSAHQVDAAAPVLSVRHLSDGQQLHDISFDIQPGEIV
GVAGLLGAGRDVLVDLLYGLRRPRSGTISIDGQAKRLRTPYQATRAGLALVPRDRRHQGL
ILPFSTADNINLASLPETATFGWEHRGKALDKARGWIEQLAIRPGRPELPVRFMSGGNQQ
KAILARWLGTDARLFILDEPTLGVDIGARSDIYQRTRELADRGRGVLVSSSDAPELLGLC
DRILVMWRGELVANLPTRGLTLDALLVTINGGQEQQV