Protein Info for BWI76_RS07890 in Klebsiella michiganensis M5al

Annotation: putative ABC-type sugar transport system permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 129 (26 residues), see Phobius details amino acids 135 to 135 (1 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 47 to 317 (271 residues), 89.6 bits, see alignment E=1e-29

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 89% identity to kva:Kvar_3728)

Predicted SEED Role

"Putative transmembrane sugar transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0N0 at UniProt or InterPro

Protein Sequence (328 amino acids)

>BWI76_RS07890 putative ABC-type sugar transport system permease component (Klebsiella michiganensis M5al)
MSAGIQRRPLPGITTLIEKFPLILFFALLVWLSLQSPFFLSWQNISMMLVQSVPLAILCF
GLVCVIAVGGDDVVSGGIDLSLPAIAVLGVALLSLGMAEWNTPYLALFLLLIAVSLACGA
VNATLVLAAGLPPLLATLSTSVAFTGLTDLLTGQRRIAVNDPLMVAFRDNDLFGIPLPLI
YLLAVFALFQFLLHHSRFGQHLQAVGGNRDMAQMSGLNVRRLTIIVWLLAGIAAGLAILP
LLSQGSGSSSGTATPLLLETVLATFIGAAFSRRRVVSIWGALLGAVLVNALSNGLGLLGV
NIFWMGAIKGGLILVVLAASAVRHKGGN