Protein Info for BWI76_RS07805 in Klebsiella michiganensis M5al

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 49 to 321 (273 residues), 112 bits, see alignment E=1.5e-36

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 96% identity to kpe:KPK_3953)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0N4 at UniProt or InterPro

Protein Sequence (332 amino acids)

>BWI76_RS07805 sugar ABC transporter permease (Klebsiella michiganensis M5al)
MSKALAVNATVSGRQRFFDFLYKWGMLLTVVLLIAVFGLASDNFLDPFNIINILRSIAIV
TVIAIGVSISLTIGGFDLSVGSTASLANALVISLFVWHGFGTTEAIVVTLALCTLVGLFN
AFLIVILRIPDMLATLASLFVIQGVAMTYSYGGSITENMVLPSGDMAEGAIPAAFGSLGQ
VPTIVIIMLVVTVIAQLALSFTTHGRRMYAIGGNPEAARLSGLRITRYKVAAYVIASLLA
GLGGILLASRIGSSQVNAGGGYLMDAVAAAWIGFSLAGSGKPNALGTLVGAVILGVLSNG
LVMLSVPYYAMDIIKGLVLAGALALTYFQRRT