Protein Info for BWI76_RS07760 in Klebsiella michiganensis M5al

Annotation: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00106: adh_short" amino acids 10 to 188 (179 residues), 150 bits, see alignment E=9.1e-48 TIGR04316: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase" amino acids 11 to 250 (240 residues), 347.8 bits, see alignment E=1.9e-108 PF13561: adh_short_C2" amino acids 15 to 248 (234 residues), 166.8 bits, see alignment E=9.5e-53 PF08659: KR" amino acids 53 to 158 (106 residues), 35.9 bits, see alignment E=1.1e-12

Best Hits

Swiss-Prot: 90% identical to ENTA_ECOLI: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (entA) from Escherichia coli (strain K12)

KEGG orthology group: K00216, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase [EC: 1.3.1.28] (inferred from 94% identity to kpu:KP1_1560)

MetaCyc: 90% identical to 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (Escherichia coli K-12 substr. MG1655)
2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase. [EC: 1.3.1.28]

Predicted SEED Role

"2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (EC 1.3.1.28) [enterobactin] siderophore" in subsystem Siderophore Enterobactin (EC 1.3.1.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.28

Use Curated BLAST to search for 1.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0G8 at UniProt or InterPro

Protein Sequence (251 amino acids)

>BWI76_RS07760 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (Klebsiella michiganensis M5al)
MNGLDFHGQTVWITGAGKGIGYATALAFVEAGAQVTGFDLAFDGESYPFATETLDVADAR
QVAQVCGRLLAGIERLDVLVNAAGILRMGATDALSQEDWQQTFAVNVGGAFNLFQQTMAQ
FRRQKGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALTVGLELAGSGVRCNLVSPGST
DTDMQRTLWVSDDAEQQRIRGFGEQFKLGIPLGKIARPQEIANTILFLASAHASHITLQD
IVVDGGSTLGA