Protein Info for BWI76_RS07755 in Klebsiella michiganensis M5al

Annotation: isochorismatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF00857: Isochorismatase" amino acids 32 to 204 (173 residues), 138.1 bits, see alignment E=3.4e-44 PF00550: PP-binding" amino acids 215 to 274 (60 residues), 32.8 bits, see alignment E=7e-12

Best Hits

Swiss-Prot: 86% identical to ENTB_ECOLI: Enterobactin synthase component B (entB) from Escherichia coli (strain K12)

KEGG orthology group: K01252, enterobactin isochorismatase [EC: 3.3.2.1] (inferred from 95% identity to kpu:KP1_1559)

MetaCyc: 86% identical to enterobactin synthase component B (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1) [enterobactin] siderophore / Apo-aryl carrier domain of EntB" in subsystem Siderophore Enterobactin (EC 3.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.1

Use Curated BLAST to search for 3.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0T0 at UniProt or InterPro

Protein Sequence (283 amino acids)

>BWI76_RS07755 isochorismatase (Klebsiella michiganensis M5al)
MAIPKLQAYALPEASDIPANKVNWAFEPSRAALLIHDMQEYFLNFWGENSPMMERVVANI
AALREFCKQNHIPVFYTAQPKEQSDEDRALLNDMWGPGLTRSPEQQQVIAALAPDDSDTV
LVKWRYSAFHRSPLEEMLKEAGRDQLIITGVYAHIGCMTTATDAFMRDIKPFFVADALAD
FSREEHLMALNYVAGRSGRVVMTEELLPLPASKAALRALVLPLLDESDEPMDDENLIDYG
LDSVRMMALAARWRKVYGDIDFVVLAKNPTIDAWWALLSREVK