Protein Info for BWI76_RS07655 in Klebsiella michiganensis M5al

Annotation: putative ribose ABC transport system ATP-binding component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 PF00005: ABC_tran" amino acids 33 to 182 (150 residues), 108.1 bits, see alignment E=5.9e-35 amino acids 285 to 442 (158 residues), 84.3 bits, see alignment E=1.3e-27

Best Hits

KEGG orthology group: None (inferred from 92% identity to eae:EAE_13565)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0K0 at UniProt or InterPro

Protein Sequence (514 amino acids)

>BWI76_RS07655 putative ribose ABC transport system ATP-binding component (Klebsiella michiganensis M5al)
MQRQELVNSQPVDSEVIIETRELSRVYPGVVALDNVNYRVYRNKVNVLIGENGAGKSTMM
KMLAGVETPSSGQIILDGAPVTLSSTHQAEKQGISIIFQELNLFPNMNVMDNIFMANEFF
QKGKINEKYQYELAKSLLERLELDVDPYTQLGELGIGHQQLVEIARALSKDTRVLIMDEP
TSALSQSEVKILFNVIEQLKRRGVTIIYISHRLEELMEIGDHITIFRDGRFISEREVSDA
SIPWIIEQMVGDKKKHFDYRPAPKGEAVLAVEGLTALHSSGGYKLNDVTFTLSKGEVIGI
YGLLGAGRTELFKGLVGLMPCQGGNVHLNGENIDKAPFQARLKKGLALVPEDRQGEGVVQ
MMSIQSNMTLSDFSLQGFRRAWKWLNPQKEIACVKEMIRELAIKVSDPELPITSLSGGNQ
QKVVLGKALMTKPEVVFLDEPTRGIDVGAKTDVYHLIGKMAQQGLAVMFSSSELDEVMAL
ADRILVMADGRITADLPRHAVTREKLIAASTPQD