Protein Info for BWI76_RS07650 in Klebsiella michiganensis M5al

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 320 (275 residues), 138 bits, see alignment E=1.7e-44

Best Hits

KEGG orthology group: None (inferred from 96% identity to eae:EAE_13560)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0D8 at UniProt or InterPro

Protein Sequence (351 amino acids)

>BWI76_RS07650 ABC transporter permease (Klebsiella michiganensis M5al)
MNQKYMIYMYLLKARTFIALLLVIAFFSVMVPNFLTTSNLLIMTQHVAITGLLAIGMTLV
ILTGGIDLSVGAVAGICGMVAGALLTNGLPLWNGSVIFFNVPEVILCVALFGVLVGFVNG
AVITRFGVAPFICTLGMMYVARGSALLFNDGSTYPNLNGMEALGNTGFSTLGSGTLMGIY
LPIWLMIGFLLLGYWLTTKTPLGRYIYAIGGNESAARLAGVPIVKAKIFVYAFSGLCSAF
VGLIVASQLQTAHPMTGNMFEMDAIGATVLGGTALAGGRGRVTGSIIGAFVIVFLADGMV
MMGVSDFWQMVIKGVVIVTAVVVDQFQQKLQNKVILMRRHEEKLAAAGATS