Protein Info for BWI76_RS07640 in Klebsiella michiganensis M5al

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00106: adh_short" amino acids 17 to 206 (190 residues), 181.8 bits, see alignment E=1.7e-57 PF08659: KR" amino acids 19 to 195 (177 residues), 48.8 bits, see alignment E=1.2e-16 PF13561: adh_short_C2" amino acids 22 to 258 (237 residues), 222.2 bits, see alignment E=1.2e-69

Best Hits

Swiss-Prot: 38% identical to FABG_THEMA: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: None (inferred from 92% identity to kpe:KPK_3987)

Predicted SEED Role

"Short chain dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0D2 at UniProt or InterPro

Protein Sequence (261 amino acids)

>BWI76_RS07640 short chain dehydrogenase (Klebsiella michiganensis M5al)
MIAKDFAQQLFNLQDRVAFVTGAGSGIGQMIAYGLASAGARVVCFDLREDGGLAETVKNI
EAIGGEACFYTGDVRQLSDLRAGVALAKSRFGRLDIAVNAAGIANANPALEMETEQWQRV
IDINLTGVWNSCKAEAELMQETGGGSIINIASMSGIIVNRGLDQAHYNCSKAGVIHLSKS
LAMEWIGKGIRVNSISPGYTATPMNTRPEMVHQTREFESQTPIQRMAKVEEMAGPALFLA
SDAASFCTGVDLVVDGGFVCW