Protein Info for BWI76_RS07605 in Klebsiella michiganensis M5al

Annotation: N-acetyltransferase GCN5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF13302: Acetyltransf_3" amino acids 36 to 173 (138 residues), 61.5 bits, see alignment E=1.5e-20 PF00583: Acetyltransf_1" amino acids 90 to 172 (83 residues), 27.8 bits, see alignment E=2.8e-10

Best Hits

Swiss-Prot: 41% identical to YIW2_YEAST: Uncharacterized protein YIR042C (YIR042C) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 86% identity to kva:Kvar_3790)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0Q2 at UniProt or InterPro

Protein Sequence (231 amino acids)

>BWI76_RS07605 N-acetyltransferase GCN5 (Klebsiella michiganensis M5al)
MPEINEFGQQVNDRVPGWQGAGLLRRTALNGRFCRLEPLDTERHAADLFAAYTLGDDSDW
TWLASNCPQSVESTAHWITGKVMDDGLVPYAVIDLHAERAVGLVSYMAIERAMGTVEIGH
VTWSRAMKNTPLGTEAVWLLLQNGFAHGYRRLEWKCDSMNLASRRAADRLGFTWEGRLRQ
RMVRKGRTRDSDMLSIIDSEWPARDAALRAWLAPENFDADGRQIKRLEDFR