Protein Info for BWI76_RS07590 in Klebsiella michiganensis M5al

Annotation: glutamate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00005: ABC_tran" amino acids 22 to 178 (157 residues), 127.8 bits, see alignment E=4.7e-41 PF13304: AAA_21" amino acids 156 to 208 (53 residues), 28.6 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 55% identical to OCCP_RHIRD: Octopine permease ATP-binding protein P (occP) from Rhizobium radiobacter

KEGG orthology group: None (inferred from 95% identity to kpe:KPK_4009)

MetaCyc: 51% identical to cystine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"ABC transporter ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0G9 at UniProt or InterPro

Protein Sequence (253 amino acids)

>BWI76_RS07590 glutamate ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MSDTTAVSVKNVSKQFDNVEVLRDINLTVEKGTVVSILGSSGSGKSTLLRCMNWLEQPDR
GEIRISGQRLGIDEHNGRAMSHRQLSKIRERVGMVFQSFNLWPHLTVQQNVSEALLHVKG
MKRDEAKAIAMQQLEKVGMAHKADVYPITLSGGQKQRVAIARSLAMSPEVILFDEPTSAL
DPELVNEVLGVMKALAAEGYTMVVVTHEMDFARQVSDEVVFLEKGLLIEKAPPEKFFSNP
DSERVRQFLQGSR