Protein Info for BWI76_RS07580 in Klebsiella michiganensis M5al

Annotation: polar amino acid ABC transporter inner membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 6 to 102 (97 residues), 97.1 bits, see alignment E=3.5e-32 PF00528: BPD_transp_1" amino acids 27 to 208 (182 residues), 72.7 bits, see alignment E=1.6e-24

Best Hits

Swiss-Prot: 30% identical to GLNM_BACSU: Probable glutamine ABC transporter permease protein GlnM (glnM) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to kpn:KPN_00573)

Predicted SEED Role

"Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0K1 at UniProt or InterPro

Protein Sequence (213 amino acids)

>BWI76_RS07580 polar amino acid ABC transporter inner membrane subunit (Klebsiella michiganensis M5al)
MDAISWQLLIEGAWTTLWISAIAIAFGVAIGLLIALVRMLRIPVIDQLLVVYISLARATP
LVTLVLFLFLSLPTVGINLDKNVAAIVALTLNTSAFNAEIWRNAFRTFPREQREAAESVG
MRRWAYFRYIMLPQMWIESLPALVNEMSFLIKGSPAIAVIGVVDLTRVTNRISSVTYEPL
SPILAAGLLYVVIIGLLLKLQGMAERKAKRLAR