Protein Info for BWI76_RS07565 in Klebsiella michiganensis M5al

Annotation: LysE type translocator family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 62 (25 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details PF01810: LysE" amino acids 14 to 204 (191 residues), 95.8 bits, see alignment E=1.2e-31

Best Hits

KEGG orthology group: None (inferred from 40% identity to mmw:Mmwyl1_2944)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0H1 at UniProt or InterPro

Protein Sequence (213 amino acids)

>BWI76_RS07565 LysE type translocator family protein (Klebsiella michiganensis M5al)
MQQLYIYILIASLTIASPGPGVLLTLTNTLNYNLRNAMAGIIGVAVGMGVISIIAASSVG
VLITTSQLTLLIVKGVGAAYLIYLGIKLYRSVPRVLNQPLSSSEDVIPTASYRFRQGLLV
SLFNPKPIVFFMALFPQFIHPQQPFIPQFSVLSITFCILVVVIHSLYGLFAHSVKTKMSS
GNAFVKLNKTGGIVFMCFAVGLIVSAVHPYLSS