Protein Info for BWI76_RS07540 in Klebsiella michiganensis M5al

Annotation: dipeptide ABC transporter ATP-binding protein DppD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF00005: ABC_tran" amino acids 26 to 185 (160 residues), 102.5 bits, see alignment E=4.4e-33 PF13304: AAA_21" amino acids 104 to 217 (114 residues), 28.4 bits, see alignment E=2.6e-10 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 234 to 320 (87 residues), 81.7 bits, see alignment E=1.6e-27 PF08352: oligo_HPY" amino acids 236 to 301 (66 residues), 59.6 bits, see alignment E=4.8e-20

Best Hits

Swiss-Prot: 46% identical to OPPD_BACSU: Oligopeptide transport ATP-binding protein OppD (oppD) from Bacillus subtilis (strain 168)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 87% identity to kpn:KPN_00568)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0F9 at UniProt or InterPro

Protein Sequence (336 amino acids)

>BWI76_RS07540 dipeptide ABC transporter ATP-binding protein DppD (Klebsiella michiganensis M5al)
MSHEAYVHIRDLRVEFRRDGQTVNAVNGVSFDVQKGEVMALIGESGSGKSVTLRALMRLH
PPKSSVLSGTLKVGEEEVLTMNAGQLRRYRGARCAMIFQEPLLAFDPVYTVGQQIVEGLR
RHEGLSRQAARERALEALRQVRIPSPERRLDAYPHEMSGGMRQRAMIALALSCNPQLLLA
DEPTTALDATVQIQILILLREQQKQRDLSIIFVTHDIGAAVEIADRVAVMYAGRIVEEAS
IEEILYRPRHPYTQVLLGSRPKEGLKKGDALRCIPGSPPDLSRLPPCCAFAERCPHARPA
CTQSQPATDQAGPRHVVSCHRWRELSPSVENQALYA