Protein Info for BWI76_RS07535 in Klebsiella michiganensis M5al

Annotation: dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF00005: ABC_tran" amino acids 41 to 190 (150 residues), 115.8 bits, see alignment E=3.7e-37 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 240 to 326 (87 residues), 93.3 bits, see alignment E=3.7e-31 PF08352: oligo_HPY" amino acids 242 to 307 (66 residues), 77.5 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 47% identical to Y3864_BRUME: Putative peptide import ATP-binding protein BMEII0864 (BMEII0864) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 91% identity to kpn:KPN_00567)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0A6 at UniProt or InterPro

Protein Sequence (347 amino acids)

>BWI76_RS07535 dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MQPFINIDLGGPAQPLLKVNNLLKHFPAGGGKAREVVQAVDDVSFAVIKGETLGVVGESG
CGKSTTARLLMQLLKQDSGELIFDGLEVGSSRLPMKAYRRQVQMVFQDSYASLNPRMTME
ESIAFGQRVHGVSAKEASEYARYLLAHVGLEPERFAHRYPHALSGGQRQRVNIARALAMK
PRLVILDEAVSALDKSVEAQVLQLLQELKRTLALTYVFISHDLHVVRWLSDRILVMYLGE
VVEIGPAEQLFTASAHPYTRALLSSMPSMDPHNRTLTSALNGDPPSPISPPSGCRFHTRC
PHARAVCAEVKPTLQSVGEGHQSACLMAQPASPWHQNIAIQEVSHVA