Protein Info for BWI76_RS07515 in Klebsiella michiganensis M5al

Annotation: glutamate--cysteine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 249 to 265 (17 residues), see Phobius details TIGR02050: carboxylate-amine ligase, YbdK family" amino acids 13 to 294 (282 residues), 346.3 bits, see alignment E=6.8e-108 PF04107: GCS2" amino acids 14 to 292 (279 residues), 260.4 bits, see alignment E=1.1e-81

Best Hits

Swiss-Prot: 81% identical to GCS2_KLEP7: Putative glutamate--cysteine ligase 2 (KPN78578_05520) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K06048, carboxylate-amine ligase [EC: 6.3.-.-] (inferred from 81% identity to kpu:KP1_1500)

MetaCyc: 72% identical to putative glutamate--cysteine ligase 2 (Escherichia coli K-12 substr. MG1655)
Glutamate--cysteine ligase. [EC: 6.3.2.2]

Predicted SEED Role

"FIG00732033: hypothetical protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.2

Use Curated BLAST to search for 6.3.-.- or 6.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0B3 at UniProt or InterPro

Protein Sequence (371 amino acids)

>BWI76_RS07515 glutamate--cysteine ligase (Klebsiella michiganensis M5al)
MPLPDFHRSEPFTLGIELELQVVNPPGFDLSQDSSALIDEIQGTLKAGEAKHDITESMLE
IATGVCRDIHQATAQLSAVQQAVLRAAARHHVQICGGGTHPFQSWQRQQISDSPRYRKTV
EHFGYLAKQATIFGQHVHVGCQNGDDAIYLLHGLSRFVPHFIALNAASPWLDGTDSGFAC
SRLNLFAAYPDNGPMPWVNNWQAFIGLFRRLSYTSMIDSMKDLHWDIRPSPRFGTVEVRV
MDTPLTISQAVNIAGFIQIIACWLLTERPFKHQPEDYLLYPFNRYQACRYGLDGINTDVN
SGEQRTLREEILQLADKLAPSAHKLNADSALEAMVRQAKQHRSEPQQMREFVANGGSLIG
LVQKHCEIWTA