Protein Info for BWI76_RS07485 in Klebsiella michiganensis M5al

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF11806: Enterochelin_N" amino acids 172 to 273 (102 residues), 66.3 bits, see alignment E=6.5e-22 PF00756: Esterase" amino acids 299 to 514 (216 residues), 91.5 bits, see alignment E=1.2e-29 PF00326: Peptidase_S9" amino acids 373 to 450 (78 residues), 25.6 bits, see alignment E=1.2e-09

Best Hits

KEGG orthology group: K07214, enterochelin esterase and related enzymes (inferred from 75% identity to cko:CKO_02588)

Predicted SEED Role

"putative esterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0I3 at UniProt or InterPro

Protein Sequence (540 amino acids)

>BWI76_RS07485 esterase (Klebsiella michiganensis M5al)
MKTAWSGLLIGMSTLPAAAMNCESPSLQGELQGKFDASGEVCFDLPTLGENYVAATLSGV
TDARLLDDNNRRLRTLLAGGPADGEQTLLFSLPVHRASSLVLHGEEGARWRFQWQMRETT
ALAKIQPLDPVSPRLQRLKRELAAGGSTAHFWQELEREGTPMVEPVDAGHKRVTFLWRGA
SRNVFILGSPAGEHDPLFRLGDSDVWFRSYVVPADTLMQYKLAPDVPQVTGSAREQRRAI
LVSAQADPLNPNSVNAAHDRWNRYSLLALNAARFCTAQRMAQPLRYGTLTRHQLRSDFLQ
NTREVLIYRPRLPQPARWTLLLFDGKTYQHEYRLANVLDALIASHRLPPINVVFIDSLDH
PRRAKELPPNPHFADFMAHELLPWLRRQGLSLSRQKTVVAGSSYGGLAASWVALRYPRQF
GNVLSLSGSYWWAPQGEEASWLTRQYQQSPRYPVRFWLQAGKFETNGPDGGIYANTLEFE
QVLKEKGYTVSFHPSSSGHDYAAWCEALISGMRDLTGLALNGKPATPDPAQQQIFNRAQR