Protein Info for BWI76_RS07475 in Klebsiella michiganensis M5al

Annotation: DNA-binding transcriptional regulator RamA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 PF00165: HTH_AraC" amino acids 15 to 56 (42 residues), 33.2 bits, see alignment E=4.5e-12 amino acids 67 to 106 (40 residues), 29.5 bits, see alignment E=6.4e-11 PF12833: HTH_18" amino acids 28 to 106 (79 residues), 81.4 bits, see alignment E=4.7e-27

Best Hits

Swiss-Prot: 98% identical to RAMA_KLEPN: Transcriptional activator RamA (ramA) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 98% identity to eae:EAE_13485)

Predicted SEED Role

"Transcriptional activator RamA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0H5 at UniProt or InterPro

Protein Sequence (113 amino acids)

>BWI76_RS07475 DNA-binding transcriptional regulator RamA (Klebsiella michiganensis M5al)
MTISAQVIDTIVEWIDDNLHQPLRIDDIARHAGYSKWHLQRLFLQYKGESLGRYIRERKL
LLAARDLRDTDQRVYDICLKYGFDSQQTFTRIFTRTFNLPPGAYRKENHSRAH