Protein Info for BWI76_RS07420 in Klebsiella michiganensis M5al

Annotation: fimbrial protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF16449: MatB" amino acids 25 to 190 (166 residues), 178.7 bits, see alignment E=4.6e-57

Best Hits

Swiss-Prot: 53% identical to ECPA_KLEP7: Common pilus major fimbrillin subunit EcpA (ecpA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 59% identity to enc:ECL_03400)

Predicted SEED Role

"CFA/I fimbrial major subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0E3 at UniProt or InterPro

Protein Sequence (192 amino acids)

>BWI76_RS07420 fimbrial protein (Klebsiella michiganensis M5al)
MKKIVLAGVVAAALISSNAMANVTTSATASWDASATKDVTSALVVTPLKSLNFQYAEGIK
AFNAQKGAFDITIQGQSGATDFTLTSQIVSNTLSRTTDASTLAVGVSWNGNALNKTTPVT
MIDTANNISAGLDALAVATAFAGADRVSTQGNFDFTIDSATSDGSTAAEFKDLTDGYWSG
DVRVQFNAEWTI