Protein Info for BWI76_RS07360 in Klebsiella michiganensis M5al

Annotation: phenylalanine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 407 to 427 (21 residues), see Phobius details amino acids 433 to 452 (20 residues), see Phobius details PF00324: AA_permease" amino acids 26 to 452 (427 residues), 425.6 bits, see alignment E=2.4e-131 PF13520: AA_permease_2" amino acids 30 to 429 (400 residues), 141 bits, see alignment E=5.4e-45

Best Hits

Swiss-Prot: 88% identical to PHEP_ECOLI: Phenylalanine-specific permease (pheP) from Escherichia coli (strain K12)

KEGG orthology group: K11732, phenylalanine-specific permease (inferred from 95% identity to kpe:KPK_4044)

MetaCyc: 88% identical to phenylalanine:H+ symporter PheP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56

Predicted SEED Role

"Phenylalanine-specific permease" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0E2 at UniProt or InterPro

Protein Sequence (458 amino acids)

>BWI76_RS07360 phenylalanine transporter (Klebsiella michiganensis M5al)
MKDASTSSETIEESGPTLHRGLQNRHIQLIALGGAIGTGLFLGIGPAIQMAGPAVLLGYA
VAGIVAFLIMRQLGEMVVEEPVSGSFAHFAYKYWGPFAGFLSGWNYWVMFVLVGMAELTA
AGIYMQYWLPDVPTWIWAAAFFLIINAVNLVNVRLYGEAEFWFALIKVLAIIGMIGFGLW
MLFGGHGGSKAGIDNLWKHGGFFATGWHGLIMSLAVIMFSFGGLELIGITAAEAQNPEKS
IPKAVNQVVYRILLFYIGSLVVLLALYPWVEIQSDSSPFVMIFHNLDSNVVASALNFVIL
VASLSVYNSGVYSNSRMLFGLSVQGNAPKFLARVSKRGVPVNSLLLSGIITSLVVVLNYL
LPQKALGLLMALVVATLLLNWIMICLAHLKFRAAQRRKGREPKFKALLSPASNYICIAFL
ALILVLMCTIDGMRLSAILLPVWILFLFAAFKTLRRTA