Protein Info for BWI76_RS07355 in Klebsiella michiganensis M5al

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF07715: Plug" amino acids 79 to 176 (98 residues), 56.8 bits, see alignment E=3.1e-19 TIGR01783: TonB-dependent siderophore receptor" amino acids 81 to 729 (649 residues), 400.1 bits, see alignment E=1e-123 PF00593: TonB_dep_Rec_b-barrel" amino acids 247 to 697 (451 residues), 122.4 bits, see alignment E=4.8e-39

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 74% identity to enc:ECL_03171)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B079 at UniProt or InterPro

Protein Sequence (729 amino acids)

>BWI76_RS07355 TonB-dependent siderophore receptor (Klebsiella michiganensis M5al)
MRTYHSSVFPLRKTLLALTIGAITHSAAAAESKKSEETMVVQATPASDFKAGGDLVVPAY
HDGQVANGGRLGMLGEQNAMDVPFSIIGYTSKLIQDQQAKTITDVVSNDAGVQPVQGYGN
YAETYRIRGLKFDGDDMTLSGLAGVVPRQVVDTAMLERVEIFKGANALLNGAASSGVGGM
INLEPKRAEDIPTANVGVDYTSDSQVGGSLDLGRRFGDDNQFGARVNLVHREGEAAVDND
KRRTTLASIGLDYRGERLRSSFDFGYQKKTFHGGPMGINISAVDFIPRLPDNTHNYTQKW
AYSDIENEFGMLRMEYDIIDKWTAYASLGAQHAHEIGLYSASKLIDRAGNATAGRLDTNR
YIDTASGMAGLRGEFATGFVSHRVNVGYSAKTQNDKTAWRMSKAADNPLVNIYDTRQVAP
PANASFGGDYDDPLTSGRTRSQGWLLSDTLGVLDDTLLFTAGARHQKVVVRNYNKTTGLQ
TDDAFDDSRWMPTYGVVYKPWKVISLYANHTEALQPGSNAPTSAKNYGESVGIIHSKQNE
VGVKADFGTIGGSLSLFEIKMPSAVLDSNGYYGLNGEQRNRGVEFNIFGEPLYGLRLNAS
ATWLDAELSKTAKGLNDGKKAIGVPGFYTVLGAEYDIKPIDGLTATARLNHSGSQYADQA
NSKKIDSYTTLDLGVRYRLALNENQNQMTVRAGVDNVTDENYWSGADDSGTYLFRGEPRT
FKVSVGYAF