Protein Info for BWI76_RS07340 in Klebsiella michiganensis M5al
Annotation: amidohydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 38% identical to YHAA_BACSU: Putative amidohydrolase YhaA (yhaA) from Bacillus subtilis (strain 168)
KEGG orthology group: None (inferred from 92% identity to eae:EAE_13335)MetaCyc: 38% identical to N-acetyl amino acid acetylase (Bacillus subtilis subtilis 168)
3.5.1.-
Predicted SEED Role
"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization
MetaCyc Pathways
- S-(2-succinyl)-L-cysteine degradation (3/4 steps found)
- S-benzyl-L-cysteine degradation (2/5 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B0F0 at UniProt or InterPro
Protein Sequence (392 amino acids)
>BWI76_RS07340 amidohydrolase (Klebsiella michiganensis M5al) MTDCVIPEIKATEDEMIAIRHYLHAHPELSLEEFNTSELVAGKLTEWGYTVTRGLAKTGV VGTLSKGDSPRTIGLRADMDALPIFEATDLPWASTVAGKMHACGHDGHTTILLAAAKYIA SPACQFNGTVHLIFQPAEEAIGGADLMIKDGLFERFPCERIFGLHNMPGLPVGKLGFYAG NFMASADTVKITITGYGGHGAHPERTVDPIVTGAALVMNLQSIVARNVPPGATAVVSVGT FQAGIASNVIPENVVMELSVRAMKPEIRDLLIKRIKELADFTAKSYGASSEVEVFDSYPV LTNSDEETEFAKALALEVFGEEGVLESISPMNASEDFAFMLQKRPGCYFLLGNGEKGGKG GCMVHNPGYDFNDDIISTGATLFVRLVETHCR