Protein Info for BWI76_RS07310 in Klebsiella michiganensis M5al

Annotation: sucrose-6-phosphate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01322: sucrose-6-phosphate hydrolase" amino acids 15 to 439 (425 residues), 574.2 bits, see alignment E=8.5e-177 PF00251: Glyco_hydro_32N" amino acids 31 to 336 (306 residues), 326.9 bits, see alignment E=1.6e-101 PF08244: Glyco_hydro_32C" amino acids 409 to 442 (34 residues), 38.5 bits, see alignment 1.2e-13

Best Hits

Swiss-Prot: 87% identical to SCRB_SALTM: Sucrose-6-phosphate hydrolase (scrB) from Salmonella typhimurium

KEGG orthology group: K01193, beta-fructofuranosidase [EC: 3.2.1.26] (inferred from 78% identity to kpu:KP1_1429)

MetaCyc: 78% identical to sucrose-6-phosphate hydrolase (Klebsiella pneumoniae)
3.2.1.-

Predicted SEED Role

"Sucrose-6-phosphate hydrolase (EC 3.2.1.B3)" (EC 3.2.1.B3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.26, 3.2.1.B3

Use Curated BLAST to search for 3.2.1.26 or 3.2.1.B3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0D1 at UniProt or InterPro

Protein Sequence (466 amino acids)

>BWI76_RS07310 sucrose-6-phosphate hydrolase (Klebsiella michiganensis M5al)
MSLPSRLPAILQAVMQGQPRALADSHYPRWHHAPVTGLMNDPNGFVEFAGRYHLFYQWNP
LACDHKFKCWAHWSSDDLLRWRHEPIALMPDEEYDRNGCYSGSAVDNNGTLTLCYTGNVK
FDDGGRTAWQCLATENADGTFTKLGPVLPLPEGYTGHVRDPKVWRHQDRWYMVLGAQDRQ
KRGKVLLFSSPDLHQWRSEGEIAGDGINGLSDAGYMWECPDLFALGDQHILICCPQGIAR
EEERFLNTYPAVWMAGGFDYDRAAFSHGELRELDAGFEFYAPQTTHTRDGRRLLVGWMGV
PDGEEMRQPTLAHGWIHQMTCLRELEFIDGQLYQRPLRELTALRGEAHGWQGNALPLAPM
EIALQTAADDALSLDFGGALTLERDASGIRLARRSLVSDEMHYRYWRGEVRTLRIFFDRS
SVEIFINDGEGVMSSRCFPAYPAQLIFSGSAPDAFCYWPLRTCMVE