Protein Info for BWI76_RS07290 in Klebsiella michiganensis M5al

Annotation: PTS beta-glucoside transporter subunit EIIBCA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 transmembrane" amino acids 102 to 130 (29 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 356 to 374 (19 residues), see Phobius details amino acids 381 to 404 (24 residues), see Phobius details amino acids 424 to 446 (23 residues), see Phobius details TIGR01995: PTS system, beta-glucoside-specific IIABC component" amino acids 3 to 617 (615 residues), 703.7 bits, see alignment E=2.2e-215 PF00367: PTS_EIIB" amino acids 9 to 41 (33 residues), 49.7 bits, see alignment (E = 3e-17) PF02378: PTS_EIIC" amino acids 108 to 388 (281 residues), 114.2 bits, see alignment E=1e-36 PF00358: PTS_EIIA_1" amino acids 474 to 598 (125 residues), 159.2 bits, see alignment E=6.1e-51 TIGR00830: PTS system, glucose subfamily, IIA component" amino acids 475 to 595 (121 residues), 138.7 bits, see alignment E=9.4e-45

Best Hits

Swiss-Prot: 38% identical to PTV3B_BACSU: PTS system beta-glucoside-specific EIIBCA component (bglP) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 71% identity to srr:SerAS9_2281)

Predicted SEED Role

"PTS system, beta-glucoside-specific IIB component (EC 2.7.1.69) / PTS system, beta-glucoside-specific IIC component (EC 2.7.1.69) / PTS system, beta-glucoside-specific IIA component (EC 2.7.1.69)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0D9 at UniProt or InterPro

Protein Sequence (626 amino acids)

>BWI76_RS07290 PTS beta-glucoside transporter subunit EIIBCA (Klebsiella michiganensis M5al)
MNYNETADKILHAVGGAENIRMLTHCATRLRMEFNDRAKVNDAQIGTLPGVISVVEKGGQ
FQIVIGNEVQQVYRRLNKALPEKKGPAGGDKNAKPAGIVARIISVISTTFTPVIPAITGA
GMIKALLAILKLTGVISETSSTYQLLNIIADAAFFFLPVLLAYGASLKFECNPILAMTLA
GVLLHPGIGQMLAAGKAVDFVGINVLLSDYAGSVLPIILTVWLMSWVERFAEKVSPSIIK
FFVKPMLILLITAPLALVVVGPAGILLNDLVAAGAGAIDRHASWLIPMLMGTLQPFLIIT
GTAWAMTPIATGQLSKSGYEMINGPGMLASNVAMGAATLCVALKTKNSNLRQLASSSGFT
ALLGITEPALYGVLLKFRRVLIAAMIGGGCAGVYAGVSGLVRYAFVSPGLAALPAFIGEN
PMNIVHALVTCAISIVVTFTLTWFIAFKDVPEEQEEVGEAPQPAVSPKNEGETEVFSPLR
GQVVALSEVNDDVFSGGLLGEGLAIRPEEGVLRAPFSGTVMMFLPSCHAVGLQSDSGLEL
LIHIGIDTVNLNGQHFSSTLKVGDRVEAGQELIRFDIPAIEQAGYDLITPVIVVNGDEQH
SLRLTAAAQVDYGEQLMVQSAKEAQA