Protein Info for BWI76_RS07275 in Klebsiella michiganensis M5al

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 40 to 42 (3 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 72 to 95 (24 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details amino acids 285 to 311 (27 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 44 to 350 (307 residues), 170.3 bits, see alignment E=2.4e-54

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 90% identity to cko:CKO_02934)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0I4 at UniProt or InterPro

Protein Sequence (368 amino acids)

>BWI76_RS07275 ABC transporter (Klebsiella michiganensis M5al)
MTTLQLDTPAVSRRFWSGMTLLVCALLVAPMVASQLGGNYWVRVIDFALLYVMLALGLNI
VVGYTGLLDMGFIAFYAVGAYLAALLASPHLLDVFPILNSWFPDGLHTSWLVIIPLAALV
AAGCGIVLGAPTLKLRGDYLAIVTLGFGEIIRILMRNLDRPVNITNGAKGISGVDSLNLF
GLKFSGVYHWFGFKVPALWLWYYLLMLVIVAIIFVCLRLQHSRIGRAWHAIREDEDVARA
MGINLRNYKLLAFAIGASFGGVAGALFGAFQGFVSPESFTLQESIAVLAMVVLGGMGHIP
GVILGAVLLTALPELLRSQAAPVQQALFGEVLIDPEVLRQLFYGLALVLVMLLRPQGIWP
ARHQGAKA