Protein Info for BWI76_RS07235 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 27 to 281 (255 residues), 214.9 bits, see alignment E=3.8e-67 PF00532: Peripla_BP_1" amino acids 38 to 230 (193 residues), 56 bits, see alignment E=1.1e-18 PF13377: Peripla_BP_3" amino acids 150 to 295 (146 residues), 26.7 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 46% identical to MOCB_RHIML: Putative rhizopine-binding protein (mocB) from Rhizobium meliloti

KEGG orthology group: K02058, simple sugar transport system substrate-binding protein (inferred from 95% identity to kpn:KPN_00509)

MetaCyc: 32% identical to ribose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Inositol transport system sugar-binding protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0A3 at UniProt or InterPro

Protein Sequence (307 amino acids)

>BWI76_RS07235 hypothetical protein (Klebsiella michiganensis M5al)
MNIKKTVVASLIACMLPAVVMAKDISVGVSMALFDDNFLTILRTAMQKEMQKDGVKAQVE
DAKGDVSQQLQQVQNFIGQGVDAIIVNPVDTNAVKPIMDQATKAGIPLIFVNRRPQAQLT
DKMAYVGSDSVLAGRLQMEALAKAMNGKGNVAILLGDLANESTRDRTKGVEEVVAKYPDI
KIVQKQTAKFTRNDAVDVVSNWMTSGEDIQAIASNNDEMAIGALQALGKNPNHILIAGVD
GTPDALQMLKNGKMIATIFQDAKGQGEGAVDAAIKLANGEKVEKVIDVPYQLITKDNMAE
FVNRNQK