Protein Info for BWI76_RS07220 in Klebsiella michiganensis M5al

Annotation: oxidoreductase NAD-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF01408: GFO_IDH_MocA" amino acids 20 to 136 (117 residues), 95.4 bits, see alignment E=2e-31

Best Hits

KEGG orthology group: None (inferred from 82% identity to kpe:KPK_4083)

Predicted SEED Role

"Myo-inositol 2-dehydrogenase (EC 1.1.1.18)" in subsystem Inositol catabolism (EC 1.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.18

Use Curated BLAST to search for 1.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0B2 at UniProt or InterPro

Protein Sequence (343 amino acids)

>BWI76_RS07220 oxidoreductase NAD-binding protein (Klebsiella michiganensis M5al)
MFPSQLPKPRHHAASAIPTLRWGIIGPGWIAERFVKSLKELSRQQVVAVSSRTQQKADAF
AARWGIPQAYAQVDEMLARPDIDAVYIATPHNHHFPDGLRALRAGKHVLIEKPFALNRRE
GAALKAEAVKQGTLAMEAMWCDYAPKYDVIRQLLEDGVLGDLHTLLADHGEFFTPDHRIF
NADLAGGPMMDLGSYLTSFSVMVGGVPQDIIARGRPAQRGVNGQISMLFNWEKGLQGLLN
TTLFSNTPGGAVVAGRDATLTLDGQFYAPGNFTLAASQGGQVLHWEEPRNRYDQLFYQAE
HFAWCVGQGLTDSPIRPLARVLENLSVMDEVRRQIGVVFNEER