Protein Info for BWI76_RS07215 in Klebsiella michiganensis M5al

Annotation: class A extended-spectrum beta-lactamase OXY-6-4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00144: Beta-lactamase" amino acids 38 to 284 (247 residues), 111.7 bits, see alignment E=4.5e-36 PF13354: Beta-lactamase2" amino acids 50 to 264 (215 residues), 130.4 bits, see alignment E=6.5e-42

Best Hits

Swiss-Prot: 99% identical to BLO1_KLEOX: Beta-lactamase OXY-1 (bla) from Klebsiella oxytoca

KEGG orthology group: K01467, beta-lactamase [EC: 3.5.2.6] (inferred from 72% identity to cro:ROD_12321)

MetaCyc: 39% identical to PSE-4 beta-lactamase (Pseudomonas aeruginosa)
Beta-lactamase. [EC: 3.5.2.6]

Predicted SEED Role

"Beta-lactamase (EC 3.5.2.6)" in subsystem Beta-lactamase or Tn552 (EC 3.5.2.6)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B049 at UniProt or InterPro

Protein Sequence (291 amino acids)

>BWI76_RS07215 class A extended-spectrum beta-lactamase OXY-6-4 (Klebsiella michiganensis M5al)
MLKSSWRKSALMAAAAVPLLLASGSLWASADAIQQKLANLEKRSGGRLGVALINTADDSQ
TLYRGDERFAMCSTGKVMAAAAVLKQSESHPDVVNKRLEIKKSDLVVWSPITEKHLQSGM
TLAELSAAALQYSDNTAMNKMISYLGGPEKVTAFAQSIGDVTFRLDRTEPALNSAIPGDK
RDTTTPLAMAESLRKLTLGNALGEQQRAQLVTWLKGNTTGGQSIRAGLPASWAVGDKTGA
GDYGTTNDIAVIWPENHAPLVLVTYFTQPQQDAKSRKEVLAAAAKIVTEGL