Protein Info for BWI76_RS07200 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 9 to 34 (26 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 373 to 392 (20 residues), see Phobius details amino acids 406 to 427 (22 residues), see Phobius details amino acids 457 to 476 (20 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 6 to 456 (451 residues), 278.4 bits, see alignment E=6.5e-87 PF07690: MFS_1" amino acids 21 to 420 (400 residues), 67.2 bits, see alignment E=1.3e-22 PF00854: PTR2" amino acids 76 to 444 (369 residues), 306.6 bits, see alignment E=2.6e-95

Best Hits

Swiss-Prot: 84% identical to DTPC_ECOLI: Dipeptide and tripeptide permease C (dtpC) from Escherichia coli (strain K12)

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 93% identity to kpu:KP1_1412)

MetaCyc: 84% identical to dipeptide/tripeptide:H+ symporter DtpC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-267; TRANS-RXN0-288

Predicted SEED Role

"Di/tripeptide permease YjdL"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0C2 at UniProt or InterPro

Protein Sequence (494 amino acids)

>BWI76_RS07200 MFS transporter (Klebsiella michiganensis M5al)
MKTPSQPRAIYYIVAIQIWEYFSFYGMRALLILYLTHQLGFDDSHAISLFSAYASLVYVT
PILGGWLADRLLGNRTAVIAGALLMTLGHVVLGVESDSTWSLYLALAIIICGYGLFKSNI
SCLLGELYAVDDPRRDGGFSLLYAAGNVGSIAAPIACGLAAQWYGWHIGFALAGIGMFVG
LMIFLSGSRYFRHARGVDKQALRAVKFVLPTWGWLVVMLCVAPVFFTLLLENNWSGYLLA
IVCVFAAQMVARIMVKSPEHRRALWQIVLLMLTGTLFWVLAQQGGSSISLFIDHFVNRRL
LNIEVPTALFQSVNAVAVMAAGVVLAWLMRPEGATRSALRVWLKFAFGLVLMGCGFMLLA
LNARHGAAQGQASMGMMVAGLALMGFAELFIDPVAMAQITRLNMPGVTGVLTGIYMLATG
AVANWLAGVVAQQTTESQISDTAIAAYQHFFAQMGEWTLGCVAVIVVVAFAAAFSVGKRR
AAAGELPGVNAQDL