Protein Info for BWI76_RS07130 in Klebsiella michiganensis M5al

Annotation: MFS family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 37 to 61 (25 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 373 to 393 (21 residues), see Phobius details PF03825: Nuc_H_symport" amino acids 6 to 395 (390 residues), 260.4 bits, see alignment E=4.6e-81 PF07690: MFS_1" amino acids 9 to 346 (338 residues), 43.6 bits, see alignment E=2.9e-15 PF12832: MFS_1_like" amino acids 11 to 358 (348 residues), 66.6 bits, see alignment E=3.4e-22

Best Hits

KEGG orthology group: None (inferred from 79% identity to pmr:PMI2969)

Predicted SEED Role

"Nucleoside permease NupG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B081 at UniProt or InterPro

Protein Sequence (411 amino acids)

>BWI76_RS07130 MFS family transporter (Klebsiella michiganensis M5al)
MDLNKTPRLLIMMFIQYFMQGAWNMTMGLVLSTYGMATIIGSSYALLGLATIISPLFIGM
VADRFFASQKVMAILHLVNAGVLLFVPQFIEAQNTGMTLTMIFLVGLLFYPTTALANSIS
FSHINGVKYFPFIRVFGTFGFMAIGFIIGEMGYSGNTVTWYIAAASGAFLGLYCFTLPNT
PPKAKGNAFALRDLLCLDALALFKDRSFSVLMLSIFVLMIPKTAYSAYIPVFLKALGFDN
AASMMQIGIACEVIFMFLLSFFLLKAGFKITLMLGAVCWIIRTLLFAHASLDANMMFVLI
GLMLQGFCWDFFFTVGDIYVDRKAAPEIKAQAQSLRFIVSNGVGLLFASTVCGQIFNTTV
TEQGPEALPQWETFWLVSAGVAAVVSVFFLIFFRDDLSKRKTDLELKKANS