Protein Info for BWI76_RS07080 in Klebsiella michiganensis M5al

Annotation: UDP-2,3-diacylglucosamine diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 88% identical to LPXH_KLEP7: UDP-2,3-diacylglucosamine hydrolase (lpxH) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K03269, UDP-2,3-diacylglucosamine hydrolase [EC: 3.6.1.-] (inferred from 89% identity to kpu:KP1_1382)

MetaCyc: 82% identical to UDP-2,3-diacylglucosamine diphosphatase (Escherichia coli K-12 substr. MG1655)
LIPIDXSYNTHESIS-RXN [EC: 3.6.1.54]

Predicted SEED Role

"UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)" (EC 3.6.1.54)

MetaCyc Pathways

superpathway of (Kdo)₂-lipid A biosynthesis (17/17 steps found)
lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
lipid IV_A biosynthesis (E. coli) (6/6 steps found)
lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
lipid IV_A biosynthesis (P. putida) (6/6 steps found)
lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
lipid IV_A biosynthesis (generic) (6/6 steps found)
lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
superpathway of Kdo₂-lipid A biosynthesis (18/25 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B075 at UniProt or InterPro

Protein Sequence (240 amino acids)

>BWI76_RS07080 UDP-2,3-diacylglucosamine diphosphatase (Klebsiella michiganensis M5al)
MATLFIADLHLQTEEPAITAGFLRFLHGEARQADALYILGDLFEAWIGDDDPNPLHRQIA
AALNALAESGVPCYFLHGNRDFLVGQRFARESAMILLPEEKLLDLYGRKVLIMHGDTLCT
DDAGYLAFRAKVHNPCIQRLFLALPLFIRRRIAARMRADSKAANSSKSMEIMDVNPQAVV
DVMEKHHVQWLIHGHTHRPAVHSLEANGKTAYRVVLGAWHSEGSMVKVTPEDVELIHFPF