Protein Info for BWI76_RS06970 in Klebsiella michiganensis M5al

Annotation: selenophosphate-dependent tRNA 2-selenouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR03167: tRNA 2-selenouridine synthase" amino acids 15 to 344 (330 residues), 331.2 bits, see alignment E=3.6e-103

Best Hits

Swiss-Prot: 75% identical to SELU_SALTY: tRNA 2-selenouridine/geranyl-2-thiouridine synthase (selU) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06917, tRNA 2-selenouridine synthase [EC: 2.9.1.-] (inferred from 86% identity to kpu:KP1_1356)

MetaCyc: 70% identical to tRNA 2-selenouridine synthase (Escherichia coli K-12 substr. MG1655)
RXN0-2281 [EC: 2.9.1.3]

Predicted SEED Role

"Selenophosphate-dependent tRNA 2-selenouridine synthase" in subsystem Selenocysteine metabolism

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.- or 2.9.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZT2 at UniProt or InterPro

Protein Sequence (361 amino acids)

>BWI76_RS06970 selenophosphate-dependent tRNA 2-selenouridine synthase (Klebsiella michiganensis M5al)
MQLVPQNIRQILASDTPLIDVRAPIEFRQSAMPAAVNLPLMNDDERAAVGTCYKRQGPEA
ALALGHQLVSGEIRASRLAAWKEACARYPEGYLCCARGGQRSHIVQQWLNDAGVDYPLIT
GGYKALRQAAIQLTEELVQRPIVLIGGCTGNGKTQLVCAQPDGIDLEGLAHHRGSSFGRT
LQEQYQQATFENHLAVAMLKKSERQTRWVLEDEGHMIGANHLPECMRIRMAQSPLAVVED
PFEIRLERLREEYFTRMHRDFLAAYGEEQGWRAYSEYLHHGLFAIRRRLGLQRFAQLTAR
LDEALLEQQRSASTEAHFSWLVPLLNEYYDPMYRYQLGKKAEKIIFRGSWQDVAAWLAQA
Q