Protein Info for BWI76_RS06825 in Klebsiella michiganensis M5al

Annotation: nucleoid-associated protein, YbaB/EbfC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 2 to 106 (105 residues), 137.7 bits, see alignment E=6.7e-45 PF02575: YbaB_DNA_bd" amino acids 12 to 100 (89 residues), 116.5 bits, see alignment E=2.4e-38

Best Hits

Swiss-Prot: 96% identical to Y444_KLEP7: Nucleoid-associated protein KPN78578_04440 (KPN78578_04440) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K09747, hypothetical protein (inferred from 95% identity to eco:b0471)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZQ1 at UniProt or InterPro

Protein Sequence (110 amino acids)

>BWI76_RS06825 nucleoid-associated protein, YbaB/EbfC family (Klebsiella michiganensis M5al)
MFGGKGGLGNLMKQAQQMQEKMQQMQEEVARLEVTGESGAGLVKVTINGAHNCRRVEIDP
SLLEDDKDMLEDLVAAAFNDAARRIEETQKEKMASVSAGMQLPPGFKMPF