Protein Info for BWI76_RS06815 in Klebsiella michiganensis M5al

Annotation: adenine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01090: adenine phosphoribosyltransferase
  • amino acids 11 to 178 (168 residues), 241.3 bits, E=3.1e-76
• PF00156: Pribosyltran
  • amino acids 31 to 155 (125 residues), 57.6 bits, E=5e-20

Best Hits

Swiss-Prot: 97% identical to APT_KLEP3: Adenine phosphoribosyltransferase (apt) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 96% identity to kpu:KP1_1327)

MetaCyc: 91% identical to adenine phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Adenine phosphoribosyltransferase. [EC: 2.4.2.7]

Predicted SEED Role

"Adenine phosphoribosyltransferase (EC 2.4.2.7)" in subsystem Purine conversions or cAMP signaling in bacteria (EC 2.4.2.7)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (13/14 steps found)
• (aminomethyl)phosphonate degradation (7/8 steps found)
• adenine salvage (3/3 steps found)
• superpathway of guanine and guanosine salvage (3/3 steps found)
• adenine and adenosine salvage I (2/2 steps found)
• adenine and adenosine salvage II (2/2 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• glyphosate degradation III (4/7 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.7

Sequence Analysis Tools

See A0A285AZN6 at UniProt or InterPro

Protein Sequence (183 amino acids)

>BWI76_RS06815 adenine phosphoribosyltransferase (Klebsiella michiganensis M5al)
MTATAQQLEYLKNSIQSIQDYPKPGILFRDVTSLLEDPKAYALSIELLAERYKDAGITKV
VGTEARGFLFGAPVALALGVGFVPVRKPRKLPRETIAESYELEYGTDQLEIHVDAIKAGD
KVLVVDDLLATGGTIDATVKLIRRLGGEVHDAAFIITLFDLGGEQRLEKRGINCYSLVPF
PGH