Protein Info for BWI76_RS06780 in Klebsiella michiganensis M5al

Annotation: MexE family multidrug efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00529: CusB_dom_1" amino acids 38 to 360 (323 residues), 55.4 bits, see alignment E=9.7e-19 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 375 (336 residues), 271.5 bits, see alignment E=4e-85 PF16576: HlyD_D23" amino acids 64 to 293 (230 residues), 43.4 bits, see alignment E=5.2e-15 PF13437: HlyD_3" amino acids 175 to 290 (116 residues), 28.4 bits, see alignment E=4.6e-10

Best Hits

Swiss-Prot: 86% identical to ACRA_ECOLI: Multidrug efflux pump subunit AcrA (acrA) from Escherichia coli (strain K12)

KEGG orthology group: K03585, membrane fusion protein (inferred from 95% identity to kpe:KPK_4236)

MetaCyc: 86% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZU9 at UniProt or InterPro

Protein Sequence (397 amino acids)

>BWI76_RS06780 MexE family multidrug efflux RND transporter periplasmic adaptor subunit (Klebsiella michiganensis M5al)
MNKNRGLTPLAVVLMLSGSLALTGCDDKPAQQGAQQMPEVGIVTLKSAPLQITTELPGRT
SAYRVAEVRPQVSGIILKRNFTEGSDIQAGVSLYQIDPATYQATYESAKGDLAKAQAAAN
MDQLTVKRYQKLLGTKYISQQDYDTAVATAQQSNAAVVAAKAAVETARINLAYTKVTSPI
SGRIGKSAVTEGALVQNGQTTALATVQQLDPIYVDVTQSSNDFLRLKQELANGKLQQENG
KAKVELVTNDGLKYPQNGTLEFSDVTVDQTTGSITLRAIFPNPDHTLLPGMFVRARLEEG
VNPDALLVPQQGVTRTPRGDASAMVVGEGDKVEVRQITATQAIGDKWLVTEGLKTGDRVI
ITGLQKVRPGVQVKAQEVVSDDKQQAAGNAQSEQPKS