Protein Info for BWI76_RS06725 in Klebsiella michiganensis M5al

Annotation: maltoporin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02264: LamB" amino acids 33 to 423 (391 residues), 378.7 bits, see alignment E=3e-117

Best Hits

Swiss-Prot: 95% identical to LAMB1_KLEP7: Maltoporin 1 (lamB1) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K02024, maltoporin (inferred from 95% identity to kpn:KPN_00433)

Predicted SEED Role

"Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZT9 at UniProt or InterPro

Protein Sequence (423 amino acids)

>BWI76_RS06725 maltoporin (Klebsiella michiganensis M5al)
MNTTLRTLSAALAAALISPSVFAASATLPGIDFHGYMRAGVGVSGDGSQAEWQKNKIGRL
GNESDTYGELELGSEVYKKNDVSFYLDSMVSMVSDGSNDNETTLDDDAQFGLRQLNLQIK
GLVPGDPNAVIWGGKRYYQRHDLHIIDTKYWNISGSGAGIENYTLGPGAVSFAWIRGDAN
DVDYRVDGDSNVNINYLDLRYAGWKPWAGSWTEFGIDYAMPNTTKKQDSYGGLYDAENGV
MLTGEISQDMLGGYNKTVLQYANKGLAQNMVSQGGGWYDMWNYVNDATGYRVINTGLIPI
TEKFSINHVLTWGSADNITDYTDKTRMLSLVARGQYQFTEYVRLIGEVGGFYQKDSYKNN
TDYKQAGEKYTIALGLADGPDFMSRPELRIFASYLNDSENGKPFEDQTANNTWNFGVQVE
AWW