Protein Info for BWI76_RS06710 in Klebsiella michiganensis M5al

Annotation: glycosyl hydrolase, family 53

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07745: Glyco_hydro_53" amino acids 40 to 399 (360 residues), 411.1 bits, see alignment E=1.6e-127

Best Hits

KEGG orthology group: K01224, arabinogalactan endo-1,4-beta-galactosidase [EC: 3.2.1.89] (inferred from 90% identity to kpe:KPK_4250)

Predicted SEED Role

"Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)" in subsystem Lactose and Galactose Uptake and Utilization (EC 3.2.1.89)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZL6 at UniProt or InterPro

Protein Sequence (400 amino acids)

>BWI76_RS06710 glycosyl hydrolase, family 53 (Klebsiella michiganensis M5al)
MKRLTPAWLAVSLACCFSSSTLAADALQTKAFSNMPADFIKGADISTLLDAEKHGAKFFN
HNNQQQDPIAILKADGVNYVRLRLWVDPKDAQGQRYGGGDNDLAATLALAKRAKAQGMKL
LLDFHYSDFWTDPGKQFKPKAWEKMDYPQLKTTIHDYTRDTIARFKQEGVLPDMVQIGNE
INGGMLWPEGKSWGQGGGEFDRLAGLLNAAIDGLKENLTAGEQVKIMLHLAEGTKNDTFR
WWFDEISKRNVPYDIIGLSMYTYWNGPISALKANMDDISKRYNKDVIVVEAAYAYTLENC
DNAENSFQAKEEKDGGYPATIQGQYNYIHDLMQAVADVPGHRGKGIFYWEPTWIAVPGNT
WATPAGMKYIHDEWKEGNARENQALFDCQGKALPSMKVFN