Protein Info for BWI76_RS06685 in Klebsiella michiganensis M5al

Annotation: cyclic diguanylate phosphodiesterase (EAL) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details PF12792: CSS-motif" amino acids 39 to 243 (205 residues), 154.4 bits, see alignment E=2.9e-49 PF00563: EAL" amino acids 277 to 501 (225 residues), 219.5 bits, see alignment E=4.4e-69

Best Hits

Swiss-Prot: 53% identical to PDEB_ECOLI: Probable cyclic di-GMP phosphodiesterase PdeB (pdeB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 78% identity to eae:EAE_12905)

Predicted SEED Role

"Uncharacterized protein ylaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZP0 at UniProt or InterPro

Protein Sequence (528 amino acids)

>BWI76_RS06685 cyclic diguanylate phosphodiesterase (EAL) domain-containing protein (Klebsiella michiganensis M5al)
MTTRHQVSLVTGVLILAIILPVILSIWLATQQAKEQFYSELDNFSVRVLARVQQVADQAR
EALKEADAHTATTCSPEHLLTMRRIAYTHRYIQEVLWLREGIPQCSSLEEHQVSVTFPAP
DHLTADGYRTWLTSVSDLGLKHKMTAMGSEHHVVMIDPVSFIDVIPLGHEEIHTLLFGTK
RDQIIISSKPLSAAVWEKIKHLDAETLTLDSTVYRLHRIPELGLAIATWSSTVPLQNKLH
QQLMLWLPIGLFTSLLASFLLLRLLRRLRSPRNGMLDALNSHAIQVYYQPIISLQSGKIV
GAEALARWRQPDGSFLSPDIFIPLAEQTGLITRLTEDIVRKIFADLGTWLRRRPEIHISI
NLSVDDLRSPKLPLLLQEQLQLWGISAQQIILEITERGFVDPQTTLPVLAGYRQAGHRIS
IDDFGTGYSSLSYLQKLDVDTLKIDKSFVDTLEYELLTPHIIEMAKALNLTTVAEGVETE
SQRDWLRMHGVQYAQGWLYSKALPKEKFILWAENNLKADSAPSVVAHL