Protein Info for BWI76_RS06580 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13412: HTH_24" amino acids 2 to 49 (48 residues), 58.7 bits, see alignment E=5.1e-20 PF13404: HTH_AsnC-type" amino acids 2 to 43 (42 residues), 57.7 bits, see alignment E=1.2e-19 PF01037: AsnC_trans_reg" amino acids 68 to 142 (75 residues), 73.3 bits, see alignment E=1.9e-24

Best Hits

Swiss-Prot: 88% identical to DECR_ECO57: DNA-binding transcriptional activator DecR (decR) from Escherichia coli O157:H7

KEGG orthology group: K05800, Lrp/AsnC family transcriptional regulator (inferred from 96% identity to kpu:KP1_1281)

Predicted SEED Role

"Putative HTH-type transcriptional regulator ybaO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZM2 at UniProt or InterPro

Protein Sequence (152 amino acids)

>BWI76_RS06580 transcriptional regulator (Klebsiella michiganensis M5al)
MLDKIDRKLLSLLQTDCTLSLQALADAVNLTTTPCWKRLKRLEDEGILRGRVALLDAEKV
GLGLTAFVLIKTQHHSSDWYCRFVSEVTQMAEVLGFWRMAGEYDYLLRVQVADMKNYDDF
YKRLVNSVPGLSDVTSSFAMEQIKYTTALPID