Protein Info for BWI76_RS06555 in Klebsiella michiganensis M5al

Annotation: thioesterase superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 PF20791: Acyl-ACP_TE_C" amino acids 3 to 106 (104 residues), 35.9 bits, see alignment E=1.4e-12 PF01643: Acyl-ACP_TE" amino acids 6 to 126 (121 residues), 29.5 bits, see alignment E=1.1e-10 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 7 to 118 (112 residues), 114.8 bits, see alignment E=1.4e-37 PF13279: 4HBT_2" amino acids 11 to 127 (117 residues), 74.5 bits, see alignment E=2.1e-24 PF03061: 4HBT" amino acids 16 to 95 (80 residues), 54.9 bits, see alignment E=1.8e-18

Best Hits

Swiss-Prot: 87% identical to FADM_ECOLI: Long-chain acyl-CoA thioesterase FadM (fadM) from Escherichia coli (strain K12)

KEGG orthology group: K12500, thioesterase III [EC: 3.1.2.-] (inferred from 92% identity to kpu:KP1_1276)

MetaCyc: 87% identical to long-chain acyl-CoA thioesterase FadM (Escherichia coli K-12 substr. MG1655)
3.1.2.-

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZI8 at UniProt or InterPro

Protein Sequence (133 amino acids)

>BWI76_RS06555 thioesterase superfamily protein (Klebsiella michiganensis M5al)
MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLESSPAFQWMTARNIAFVVVNININY
RRPAVLGDVLTVTSKLEKLNGKSGTLSQVVTLNPNGEVVADALITFVCIDLKTQKALPLE
GELREKLEQLEPR