Protein Info for BWI76_RS06540 in Klebsiella michiganensis M5al

Annotation: DNA-binding protein HU-beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 PF00216: Bac_DNA_binding" amino acids 1 to 90 (90 residues), 116.4 bits, see alignment E=5.7e-38 PF18291: HU-HIG" amino acids 2 to 89 (88 residues), 29.5 bits, see alignment E=6.9e-11

Best Hits

Swiss-Prot: 96% identical to DBHB_ECOLI: DNA-binding protein HU-beta (hupB) from Escherichia coli (strain K12)

KEGG orthology group: K03530, DNA-binding protein HU-beta (inferred from 96% identity to eco:b0440)

Predicted SEED Role

"DNA-binding protein HU-beta" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZR7 at UniProt or InterPro

Protein Sequence (90 amino acids)

>BWI76_RS06540 DNA-binding protein HU-beta (Klebsiella michiganensis M5al)
MNKSQLIDKIAAGADISKAAAGRALDALIASVTESLQAGDDVALVGFGTFAVKERAARTG
RNPQTGKEITIAAAKVPGFRAGKALKDAVN