Protein Info for BWI76_RS06510 in Klebsiella michiganensis M5al

Annotation: BolA family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF01722: BolA" amino acids 11 to 84 (74 residues), 96.2 bits, see alignment E=5.8e-32

Best Hits

Swiss-Prot: 92% identical to BOLA_ECOL6: DNA-binding transcriptional regulator BolA (bolA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K05527, BolA protein (inferred from 92% identity to ecz:ECS88_0431)

Predicted SEED Role

"Cell division protein BolA" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZJ5 at UniProt or InterPro

Protein Sequence (105 amino acids)

>BWI76_RS06510 BolA family transcriptional regulator (Klebsiella michiganensis M5al)
MMIREQIEAKLRAAFDPVYLEVVDESYRHNVPAGSESHFKVVLVSDRFLGERFLNRHRMI
YGTLTEELSSTVHALALHTYTIKEWEGLQDTVFASPPCRGAGSIA