Protein Info for BWI76_RS06445 in Klebsiella michiganensis M5al

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 PF01266: DAO" amino acids 8 to 87 (80 residues), 38.5 bits, see alignment E=2.6e-13 PF00890: FAD_binding_2" amino acids 8 to 544 (537 residues), 314.1 bits, see alignment E=4.7e-97 PF12831: FAD_oxidored" amino acids 8 to 48 (41 residues), 35.6 bits, see alignment 1.7e-12 PF13450: NAD_binding_8" amino acids 11 to 45 (35 residues), 22.7 bits, see alignment (E = 2.5e-08)

Best Hits

KEGG orthology group: None (inferred from 80% identity to kva:Kvar_3997)

Predicted SEED Role

"Succinate dehydrogenase/fumarate reductase, flavoprotein subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZM0 at UniProt or InterPro

Protein Sequence (567 amino acids)

>BWI76_RS06445 FAD-dependent oxidoreductase (Klebsiella michiganensis M5al)
MGGQINVDVLVVGSGAAGLSAAVTAALGGASVLVAEKESVIGGTSAWSGGWLWIPRNPLA
REEGIEEEPGSPLTYLRHEMDGEPADARLLAYLQYGPEMIDFFRRRTAVQFLSGSKMPDF
HASPGAALGGRSVTAQPFDGRLLGDWLHRLRPPLETISLAGMGIAGGTDMAHFFNATRSP
RSALYATCRLLRHGWQRLRAGRGQHLVNGNALVARLLRSALDAGVNFQLNAPVERLLADN
NGVTGAILRSDSGALEVRAGAVILACGGFPHDRQRLAEQVPHAASGYGHFSAAPPGNQGD
GIRLGETVGGQFDHSLRHPMAWAPVSRVTLASGVQLPFPHLVERAKPGFIAVLPNGKRFT
NEADSYHDFIAALLDSTPPGETPQAWLIADSRALRRYGLGHARPFPFTPEAWRRTGYLQT
GETPEALAKACAINPQQLTETIARFNDFVDQGEDKDFQRGASAYNRAQGDASRSPHPTLG
KLSHAPFYAVHILPGSLGSFSGLITDENARVLNAQQQPIQGLFAIGNDMSSVMRGFYPSG
GITLGPAMTFGYLVGKNLAANINKTTQ