Protein Info for BWI76_RS06415 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details amino acids 368 to 388 (21 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 354 (335 residues), 147.3 bits, see alignment E=5.8e-47 amino acids 278 to 387 (110 residues), 36.9 bits, see alignment E=2.1e-13 PF00083: Sugar_tr" amino acids 46 to 191 (146 residues), 42.6 bits, see alignment E=4.1e-15

Best Hits

Swiss-Prot: 82% identical to YAJR_ECOLI: Inner membrane transport protein YajR (yajR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_12700)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZM9 at UniProt or InterPro

Protein Sequence (454 amino acids)

>BWI76_RS06415 MFS transporter (Klebsiella michiganensis M5al)
MNDNKMTPGELRATWGLGTVFSLRMLGMFMVLPVLTTYGMVLQGASEALIGLAIGIYGLA
QAIFQIPFGLLSDRIGRKPLIVGGLLIFVVGSVIAALSDSIWGIILGRALQGSGAIAAAV
MALLSDLTREQNRTKAMAFIGVSFGVTFAIAMVLGPIVTHQLGLHALFWMIAFLATLGIL
LTLWVVPNSQNHVLNRESGMVKGCFSKVLAEPKLLKLNFGIMCLHIMLMSTFVALPGQLE
AAGFPAAEHWKIYLVTMLVSFVAVVPFIIYAEVKRKMKRVFLLCVAILLIAEIVLWGAGG
YFWELVAGVQLFFLAFNLLEALLPSLISKESPAGYKGTAMGIYSTSQFLGVAIGGALGGW
VDGFFDSQTVFLLGALLAMLWLLVASTMSEPPYVSSLRVEIPEDIAADKMLEERLQAKEG
VKEALVIAEERSVYIKIDSKITNRFEIEQAIKGI